Product Added to your Cart
x

-------- OR --------

EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Fashion
2 product(s) found for "Fashion"
ZARA MAN waistcoat
Fashion
ZARA MAN waistcoat
ZARA MAN brand, black watch tartan waistcoat; size Small, to fit chest 36 inches; inside pocket and two exterior front pockets; unused, with original label tag and spare button; exterior and lining 100%...
30,00 €
Units in Stock: 1
30,00 €
Details
Add To Cart
ZARA MAN brand, black watch tartan waistcoat; size Small, to fit chest 36 inches; inside pocket and two exterior front pockets; unused, with original label tag and spare button; exterior and lining 100%...
TOPMAN shirt
Fashion
TOPMAN shirt
TOPMAN brand red short-sleeved shirt, XS Extra Small, to fit chest 34-36 inches or 86-91 centimetres, Slim Fit, 100% cotton. Refurbished with original label price tag.
20,00 €
Units in Stock: 1
20,00 €
Details
Add To Cart
TOPMAN brand red short-sleeved shirt, XS Extra Small, to fit chest 34-36 inches or 86-91 centimetres, Slim Fit, 100% cotton. Refurbished with original label price tag.
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i